PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00058.96
Common NameAMTR_s00058p00133630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 407aa    MW: 45715.1 Da    PI: 6.5113
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00058.96genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.18.6e-28189243156
                                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                              k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  evm_27.model.AmTr_v1.0_scaffold00058.96 189 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 243
                                              5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.152186245IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-26187246IPR009057Homeodomain-like
SuperFamilySSF466893.05E-18187246IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-26189243IPR006447Myb domain, plants
PfamPF002494.2E-8192241IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MLAVRSLASP YDKREEERCS DGDEEREVDS SFLVLENGLV FDDLFFDIDD TDILPELELD  60
LEMLADLSSD DHQFLSLQKQ EEEDENQPSF SFQEEENHPS ISLQERQNPT FSLKREDSPS  120
SPLQREKHTT FSLQKGEHPI PPPPSPSQPQ NSSEDSSSQK TGKKSRSSSS SSEVDKSQKS  180
KRGAQGKRKV KVDWTPELHR RFVQAVEQLG VDKAVPSRIL ELMGIDCLTR HNIASHLQKY  240
RSHRKHLLAR EAEAASWSQR RQMYWGGVNN HNIKRDFLSP LSNHNPHAWP IHSIGFPPPH  300
LRPLHVWGHP TVDPSHVWSK HLVPSLSPPP PPPPPPWPPH APPPPAEAPP YWHPHNLTGT  360
SGPTPGTPFY PMRFPVTPVQ GVPPAGVALP PAPADPLMQF DLHPKK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-15186241257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011623599.10.0PREDICTED: probable transcription factor GLK1 isoform X1
SwissprotQ9SIV31e-61GLK1_ARATH; Transcription activator GLK1
TrEMBLW1PFT50.0W1PFT5_AMBTC; Uncharacterized protein
STRINGPGSC0003DMT4000242652e-77(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28401529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.11e-52GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]